PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_015874094.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus
Family Dof
Protein Properties Length: 356aa    MW: 37858.2 Da    PI: 10.1155
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_015874094.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof1252.4e-3976136262
          zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                     +e+alkcprC+stntkfCy+nnysl+qPr+fCk+CrryWt+GGalrnvPvGgg+r+nkks+
  XP_015874094.1  76 PEAALKCPRCESTNTKFCYFNNYSLTQPRHFCKTCRRYWTRGGALRNVPVGGGCRRNKKSK 136
                     67899*****************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-3163129IPR003851Zinc finger, Dof-type
PfamPF027011.0E-3279134IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.46980134IPR003851Zinc finger, Dof-type
PROSITE patternPS01361082118IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 356 aa     Download sequence    Send to blast
MVFSSIPVYL DPPNWHQQNH HRLGSGGNSS ETPQLPPLPP PPPPHVGVGG GSGGGIGSIR  60
PGSMADRARL AKLPQPEAAL KCPRCESTNT KFCYFNNYSL TQPRHFCKTC RRYWTRGGAL  120
RNVPVGGGCR RNKKSKSNNR SKSPVSTERP MGGSSSTNLM INPSGSDVVS RLLPPPQQNQ  180
SSSFMLSIQN HLSRFAGGGG GGGNLGLNFS EIQVPGDIGF PMGGNSGGNN VMLPGGEADQ  240
WRLQQFPPLM GNGFDSSSSS GLYPFQVGTE GVVEPVLPPM VGESQLIRNF SSSRVSQINN  300
NPPVKREDNH QGLNLSSSRP TLNAISENNN QFWGGSPWST DISGGLNSSS SSSHLL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015874094.10.0PREDICTED: dof zinc finger protein DOF2.4 isoform X2
TrEMBLA0A067L7632e-97A0A067L763_JATCU; Uncharacterized protein
STRINGPOPTR_0001s24540.11e-85(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37590.12e-43DNA binding with one finger 2.4